EMBOSS: needle


Program needle

Function

Needleman-Wunsch global alignment

Description

This program uses the Needleman-Wunsch global alignment algorithm to find the optimum alignment (including gaps) of two sequences when considering their entire length.

The Needleman-Wunsch algorithm is a member of the class of algorithms that can calculate the best score and alignment in the order of mn steps, (where 'n' and 'm' are the lengths of the two sequences). These dynamic programming algorithms were first developed for protein sequence comparison by Needleman and Wunsch, though similar methods were independently devised during the late 1960's and early 1970's for use in the fields of speech processing and computer science.

What is the optimal alignment? Dynamic programming methods ensure the optimal global alignment by exploring all possible alignments and choosing the best. It does this by reading in a scoring matrix that contains values for every possible residue or nucleotide match. Needle finds an alignment with the maximum possible score where the score of an alignment is equal to the sum of the matches taken from the scoring matrix.

An important problem is the treatment of gaps, i.e., spaces inserted to optimise the alignment score. A penalty is subtracted from the score for each gap opened (the 'gap open' penalty) and a penalty is subtracted from the score for the total number of gap spaces multiplied by a cost (the 'gap extension' penalty).

Typically, the cost of extending a gap is set to be 5-10 times lower than the cost for opening a gap.

Usage

Here is a sample session with needle.

% needle sw:hba_human sw:hbb_human

Gap opening penalty [10.0]: 
Gap extension penalty [0.5]: 
Output file [hba_human.needle]: 

Command line arguments

   Mandatory qualifiers:
  [-sequencea]         sequence   Sequence USA
  [-seqall]            seqall     Sequence database USA
   -gapopen            float      The gap open penalty is the score taken away
                                  when a gap is created. The best value
                                  depends on the choice of comparison matrix.
                                  The default value assumes you are using the
                                  EBLOSUM62 matrix for protein sequences, and
                                  the EDNAMAT matrix for nucleotide sequences.
   -gapextend          float      The gap extension, penalty is added to the
                                  standard gap penalty for each base or
                                  residue in the gap. This is how long gaps
                                  are penalized. Usually you will expect a few
                                  long gaps rather than many short gaps, so
                                  the gap extension penalty should be lower
                                  than the gap penalty. An exception is where
                                  one or both sequences are single reads with
                                  possible sequencing errors in which case you
                                  would expect many single base gaps. You can
                                  get this result by setting the gap open
                                  penalty to zero (or very low) and using the
                                  gap extension penalty to control gap
                                  scoring.
   -outfile            outfile    Output file name

   Optional qualifiers:
   -datafile           matrixf    Matrix file

   Advanced qualifiers:
   -showinternals      bool       Show debugging information on the internal
                                  state of the search.


Mandatory qualifiers Allowed values Default
[-sequencea]
(Parameter 1)
Sequence USA Readable sequence Required
[-seqall]
(Parameter 2)
Sequence database USA Readable sequence(s) Required
-gapopen The gap open penalty is the score taken away when a gap is created. The best value depends on the choice of comparison matrix. The default value assumes you are using the EBLOSUM62 matrix for protein sequences, and the EDNAMAT matrix for nucleotide sequences. Floating point number from 1.0 to 100.0 10.0 for any sequence
-gapextend The gap extension, penalty is added to the standard gap penalty for each base or residue in the gap. This is how long gaps are penalized. Usually you will expect a few long gaps rather than many short gaps, so the gap extension penalty should be lower than the gap penalty. An exception is where one or both sequences are single reads with possible sequencing errors in which case you would expect many single base gaps. You can get this result by setting the gap open penalty to zero (or very low) and using the gap extension penalty to control gap scoring. Floating point number from 0.0 to 10.0 0.5 for any sequence
-outfile Output file name Output file <sequence>.needle
Optional qualifiers Allowed values Default
-datafile Matrix file Comparison matrix file in EMBOSS data path EBLOSUM62 for protein
EDNAMAT for DNA
Advanced qualifiers Allowed values Default
-showinternals Show debugging information on the internal state of the search. Yes/No No

Input file format

Any 2 sequence USAs of the same type (DNA or protein).

Output file format

Here is the output file from the example run:

Global: HBA_HUMAN vs HBB_HUMAN
Score: 290.50

HBA_HUMAN       1      VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFP 44   
                        |:| :|: | | ||||  :  | | ||| |: : :| |: :| 
HBB_HUMAN       1     VHLTPEEKSAVTALWGKV..NVDEVGGEALGRLLVVYPWTQRFFE 43   

HBA_HUMAN       45    HF.DLS.....HGSAQVKGHGKKVADALTNAVAHVDDMPNALSAL 83   
                       | |||      |: :|| |||||  | :: :||:|::    : |
HBB_HUMAN       44    SFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATL 88   

HBA_HUMAN       84    SDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKF 128  
                      |:||  || ||| ||:|| : |:  || |   |||| | |:  | 
HBB_HUMAN       89    SELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKV 133  

HBA_HUMAN       129   LASVSTVLTSKYR                                 141  
                      :| |:  |  || 
HBB_HUMAN       134   VAGVANALAHKYH                                 146  

Data files

For protein sequences EBLOSUM62 is used for the substitution matrix. For nucleotide sequence, EDNAMAT is used. Others can be specified.

EMBOSS data files are distributed with the application and stored in the standard EMBOSS data directory, which is defined by EMBOSS environment variable EMBOSS_DATA.

Users can provide their own data files in their own directories. Project specific files can be put in the current directory, or for tidier directory listings in a subdirectory called ".embossdata". Files for all EMBOSS runs can be put in the user's home directory, or again in a subdirectory called ".embossdata".

The directories are searched in the following order:

Notes

References

  1. Needleman, S. B. and Wunsch, C. D. (1970) J. Mol. Biol. 48, 443-453.
  2. Kruskal, J. B. (1983) An overview of squence comparison In D. Sankoff and J. B. Kruskal, (ed.), Time warps, string edits and macromolecules: the theory and practice of sequence comparison, pp. 1-44 Addison Wesley.

Warnings

needle is for aligning two sequences over their entire length. This works best with closely related sequences. If you use needle to align very distantly-related sequences, it will produce a result but much of the alignment may have little or no biological significance.

The memory and time required to do the search is proportional to (on the order of) mn, where 'n' and 'm' are the lengths of the two sequences. This means that aligning two 1000-residue sequences takes roughly 100 times longer and uses 100 times more memory than aligning two 100-residue sequences.

Diagnostic Error Messages

Exit status

0 upon successful completion.

Known bugs

See also

Program nameDescription
stretcherFinds the best global alignment between two sequences

When you want an alignment that covers the whole length of both sequences, use needle.

When you are trying to find the best region of similarity between two sequences, use water.

Author(s)

This application was written by Alan Bleasby (ableasby@hgmp.mrc.ac.uk)

History

Completed 8th July 1999.
Last modified 26th July 1999.

Target users

This program is intended to be used by everyone and everything, from naive users to embedded scripts.

Comments