|
|
EMBOSS: patmatmotifs |
For a description of PROSITE, we can do no better than to quote the PROSITE user's documentation:
PROSITE is a method of determining what is the function of uncharacterized proteins translated from genomic or cDNA sequences. It consists of a database of biologically significant sites and patterns formulated in such a way that with appropriate computational tools it can rapidly and reliably identify to which known family of protein (if any) the new sequence belongs.
In some cases the sequence of an unknown protein is too distantly related to any protein of known structure to detect its resemblance by overall sequence alignment, but it can be identified by the occurrence in its sequence of a particular cluster of residue types which is variously known as a pattern, motif, signature, or fingerprint. These motifs arise because of particular requirements on the structure of specific region(s) of a protein which may be important, for example, for their binding properties or for their enzymatic activity. These requirements impose very tight constraints on the evolution of those limited (in size) but important portion(s) of a protein sequence. To paraphrase Orwell, in Animal Farm, we can say that "some regions of a protein sequence are more equal than others" !
The use of protein sequence patterns (or motifs) to determine the function(s) of proteins is becoming very rapidly one of the essential tools of sequence analysis. This reality has been recognized by many authors, as it can be illustrated from the following citations from two of the most well known experts of protein sequence analysis, R.F. Doolittle and A.M. Lesk:
"There are many short sequences that are often (but not always)
diagnostics of certain binding properties or active sites. These can be
set into a small subcollection and searched against your sequence (1)".
"In some cases, the structure and function of an unknown protein which
is too distantly related to any protein of known structure to detect
its affinity by overall sequence alignment may be identified by its
possession of a particular cluster of residues types classified as a
motifs. The motifs, or templates, or fingerprints, arise because of
particular requirements of binding sites that impose very tight
constraint on the evolution of portions of a protein sequence (2)."
The home web page of PROSITE is: http://www.expasy.ch/prosite/
It is common to find that a search of the PROSITE database against a protein sequence will report many matches to the short motifs that are indicative of the post-translational modification sites, such as glycolsylation, myristylation and phosphorylation sites. These reports are often unwanted and can optionally be turned off.
Your EMBOSS administrator must have set up the local EMBOSS PROSITE database using the utility 'prosextract' before this program will run.
% patmatmotifs -full Matching Prosite Motif Database to a single sequence. Input sequence: sw:12s1_arath Output file [12s1_arath.patmatmotifs]:
Mandatory qualifiers:
[-sequence] sequence Sequence USA
[-outfile] outfile Output file name
Optional qualifiers: (none)
Advanced qualifiers:
-full bool Provide documentation for matching patterns
-[no]prune bool Don't use simple patterns. It this is true
then these simple post-translational
modification sites are not reported:
myristyl, asn_glycosylation,
camp_phospho_site, pkc_phospho_site,
ck2_phospho_site, and tyr_phospho_site.
|
| Mandatory qualifiers | Allowed values | Default | |
|---|---|---|---|
| [-sequence] (Parameter 1) |
Sequence USA | Readable sequence | Required |
| [-outfile] (Parameter 2) |
Output file name | Output file | <sequence>.patmatmotifs |
| Optional qualifiers | Allowed values | Default | |
| (none) | |||
| Advanced qualifiers | Allowed values | Default | |
| -full | Provide documentation for matching patterns | Yes/No | No |
| -[no]prune | Don't use simple patterns. It this is true then these simple post-translational modification sites are not reported: myristyl, asn_glycosylation, camp_phospho_site, pkc_phospho_site, ck2_phospho_site, and tyr_phospho_site. | Yes/No | Yes |
The output is a report of the start and end position of any matches of PROSITE entries to the input sequence.
Optionally (using the qualifier '-full'), the full description of the prosite entry is also reported.
The output from the above example follows:
Number of matches found in this Sequence = 1
Length of the sequence = 472 basepairs
Start of match = position 282 of sequence
End of match = position 304 of sequence
Length of motif = 23
patmatmotifs of 11S_SEED_STORAGE with 12S1_ARATH from 282 to 304
HGRHGNGLEETICSARCTDNLDDPSRADVYKPQ
| |
282 304
**********************************************
* 11-S plant seed storage proteins signature *
**********************************************
Plant seed storage proteins, whose principal function appears to be the major
nitrogen source for the developing plant, can be classified, on the basis of
their structure, into different families. 11-S are non-glycosylated proteins
which form hexameric structures [1,2]. Each of the subunits in the hexamer is
itself composed of an acidic and a basic chain derived from a single precursor
and linked by a disulfide bond. This structure is shown in the following
representation.
+-------------------------+
| |
xxxxxxxxxxxCxxxxxxxxxxxxxxxxxxxxxxNGxCxxxxxxxxxxxxxxxxxxxxxxx
*********
<------Acidic-subunit-------------^gt;<-----Basic-subunit------>
<-----------------About-480-to-500-residues----------------->
'C': conserved cysteine involved in a disulfide bond.
'*': position of the pattern.
Proteins that belong to the 11-S family are: pea and broad bean legumins, rape
cruciferin, rice glutelins, cotton beta-globulins, soybean glycinins, pumpkin
11-S globulin, oat globulin, sunflower helianthinin G3, etc.
As a signature pattern for this family of proteins we used the region that
includes the conserved cleavage site between the acidic and basic subunits
(Asn-Gly) and a proximal cysteine residue which is involved in the interchain
disulfide bond.
-Consensus pattern: N-G-x-[DE](2)-x-[LIVMF]-C-[ST]-x(11,12)-[PAG]-D
[C is involved in a disulfide bond]
-Sequences known to belong to this class detected by the pattern: ALL.
-Other sequence(s) detected in SWISS-PROT: NONE.
-Last update: June 1994 / Pattern and text revised.
[ 1] Hayashi M., Mori H., Nishimura M., Akazawa T., Hara-Nishimura I.
Eur. J. Biochem. 172:627-632(1988).
[ 2] Shotwell M.A., Afonso C., Davies E., Chesnut R.S., Larkins B.A.
Plant Physiol. 87:698-704(1988).
***************
Bairoch A., Bucher P., Hofmann K. The PROSITE datatase, its status in 1997. Nucleic Acids Res. 24:217-221(1997).
"Either EMBOSS_DATA undefined or PROSEXTRACT needs running"
indicates that your local EMBOSS administrator has not yet correctly set up the local EMBOSS PROSITE database using the utility 'prosextract'.
| Program name | Description |
|---|---|
| dreg | regular expression search of a nucleotide sequence |
| fuzznuc | Nucleic acid pattern search |
| fuzzpro | Protein pattern search |
| fuzztran | Protein pattern search after translation |
| helixturnhelix | Report nucleic acid binding motifs |
| patmatdb | Search a protein sequence with a motif |
| preg | regular expression search of a protein sequence |
| printsextract | Extract data from PRINTS |
| prosextract | Builds the PROSITE motif database for patmatmotifs to search |
| pscan | Scans proteins using PRINTS |
| tfscan | Scans DNA sequences for transcription factors |