|
|
EMBOSS: sigcleave |
% sigcleave Reports peptide signal cleavage sites Input sequence: sw:ach2_drome Output file [ach2_drome.out]: Minimum weight [3.5]:
Mandatory qualifiers:
[-sequence] seqall Sequence database USA
[-outfile] outfile Output file name
-minweight float Minimum scoring weight value for the
predicted cleavage site
Optional qualifiers:
-prokaryote bool Specifies the sequence is prokaryotic and
changes the default scoring data file name
Advanced qualifiers:
-pval integer Specifies the number of columns before the
residue at the cleavage site in the weight
matrix table
-nval integer specifies the number of columns after the
residue at the cleavage site in the weight
matrix table
|
| Mandatory qualifiers | Allowed values | Default | |
|---|---|---|---|
| [-sequence] (Parameter 1) |
Sequence database USA | Readable sequence(s) | Required |
| [-outfile] (Parameter 2) |
Output file name | Output file | <sequence>.sigcleave |
| -minweight | Minimum scoring weight value for the predicted cleavage site | Number from 0.000 to 100.000 | 3.5 |
| Optional qualifiers | Allowed values | Default | |
| -prokaryote | Specifies the sequence is prokaryotic and changes the default scoring data file name | Yes/No | No |
| Advanced qualifiers | Allowed values | Default | |
| -pval | Specifies the number of columns before the residue at the cleavage site in the weight matrix table | Integer from -13 to -1 | -13 |
| -nval | specifies the number of columns after the residue at the cleavage site in the weight matrix table | Integer 1 or more | Pval+15 (2) |
SIGCLEAVE of ACH2_DROME from 1 to 576
Reporting scores over 3.50
Maximum score 13.7 at residue 42
Sequence: LLVLLLLCETVQA-NPDAKRLYDDLLSNYNRLIRPVSNNTDTVLVKLGLRLSQLIDLNLKDQIL
| (signal) | (mature peptide)
29 42
Other entries above 3.50
Score 12.1 at residue 39
Sequence: LCLLLVLLLLCET-VQANPDAKRLYDDLLSNYNRLIRPVSNNTDTVLVKLGLRLSQLIDLNLKD
| (signal) | (mature peptide)
26 39
Score 10.5 at residue 41
Sequence: LLLVLLLLCETVQ-ANPDAKRLYDDLLSNYNRLIRPVSNNTDTVLVKLGLRLSQLIDLNLKDQI
| (signal) | (mature peptide)
28 41
EMBOSS data files are distributed with the application and stored in the standard EMBOSS data directory, which is defined by EMBOSS environment variable EMBOSS_DATA.
Users can provide their own data files in their own directories. Project specific files can be put in the current directory, or for tidier directory listings in a subdirectory called ".embossdata". Files for all EMBOSS runs can be put in the user's home directory, or again in a subdirectory called ".embossdata".
The directories are searched in the following order:
# Amino acid counts for 161 Eukaryotic Signal Peptides, # from von Heijne (1986), Nucl. Acids. Res. 14:4683-4690 # # The cleavage site is between +1 and -1 # Sample: 161 aligned sequences # # R -13 -12 -11 -10 -9 -8 -7 -6 -5 -4 -3 -2 -1 +1 +2 Expect # - --- --- --- --- --- --- --- --- --- --- --- --- --- --- --- ------ A 16 13 14 15 20 18 18 17 25 15 47 6 80 18 6 14.5 C 3 6 9 7 9 14 6 8 5 6 19 3 9 8 3 4.5 D 0 0 0 0 0 0 0 0 5 3 0 5 0 10 11 8.9 E 0 0 0 1 0 0 0 0 3 7 0 7 0 13 14 10.0 F 13 9 11 11 6 7 18 13 4 5 0 13 0 6 4 5.6 G 4 4 3 6 3 13 3 2 19 34 5 7 39 10 7 12.1 H 0 0 0 0 0 1 1 0 5 0 0 6 0 4 2 3.4 I 15 15 8 6 11 5 4 8 5 1 10 5 0 8 7 7.4 K 0 0 0 1 0 0 1 0 0 4 0 2 0 11 9 11.3 L 71 68 72 79 78 45 64 49 10 23 8 20 1 8 4 12.1 M 0 3 7 4 1 6 2 2 0 0 0 1 0 1 2 2.7 N 0 1 0 1 1 0 0 0 3 3 0 10 0 4 7 7.1 P 2 0 2 0 0 4 1 8 20 14 0 1 3 0 22 7.4 Q 0 0 0 1 0 6 1 0 10 8 0 18 3 19 10 6.3 R 2 0 0 0 0 1 0 0 7 4 0 15 0 12 9 7.6 S 9 3 8 6 13 10 15 16 26 11 23 17 20 15 10 11.4 T 2 10 5 4 5 13 7 7 12 6 17 8 6 3 10 9.7 V 20 25 15 18 13 15 11 27 0 12 32 3 0 8 17 11.1 W 4 3 3 1 1 2 6 3 1 3 0 9 0 2 0 1.8 Y 0 1 4 0 0 1 3 1 1 2 0 5 0 1 7 5.6
If you use matrix tables with a different number of residues before or after the cleavage site, you must also set the advanced parameters nval and pval.
| Program name | Description |
|---|---|
| antigenic | Finds antigenic sites in proteins |
| diffseq | Find differences (SNPs) between nearly identical sequences |
| dotmatcher | Displays a thresholded dotplot of two sequences |
| dotpath | Displays a non-overlapping wordmatch dotplot of two sequences |
| dottup | Displays a wordmatch dotplot of two sequences |
| garnier | Predicts protein secondary structure |
| helixturnhelix | Report nucleic acid binding motifs |
| oddcomp | Finds protein sequence regions with a biased composition |
| pepcoil | Predicts coiled coil regions |
| pepnet | Displays proteins as a helical net |
| pepwheel | Shows protein sequences as helices |
| polydot | Displays all-against-all dotplots of a set of sequences |
| pscan | Scans proteins using PRINTS |
| showseq | Display a sequence with features, translation etc |
| tmap | Displays membrane spanning regions |
Original program "SIGCLEAVE" by Peter Rice (EGCG 1989)